PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco028479.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family YABBY
Protein Properties Length: 137aa    MW: 15073.1 Da    PI: 9.0021
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco028479.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY145.94.2e-45312823159
        YABBY  23 avsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekeesastsvsseklsenedeevprvppvirPPe 120
                   vsvPs+s+f ++tvrCG Ct+llsv++   +q ++ +          ++++ ++++++ ++    ++s+  +++s  l+ + +++  ++ p   PPe
  Aco028479.1   3 QVSVPSNSMFDILTVRCGNCTNLLSVDMGAVTQKIPLQGS--------QVHNIGSHHDHNSVDCGGSSSKC-NRRSPVLD-SIQNDPHKTLP-TPPPE 89 
                  69******************************99999886........56666666655444444333333.33333333.33333333334.68*** PP

        YABBY 121 krqrvPsaynrfikeeiqrikasnPdishreafsaaakn 159
                  krqrvPsaynrfikeeiqrika+nPdishreafs+aakn
  Aco028479.1  90 KRQRVPSAYNRFIKEEIQRIKANNPDISHREAFSTAAKN 128
                  **************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046902.4E-473128IPR006780YABBY protein
SuperFamilySSF470954.84E-778126IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
Sequence ? help Back to Top
Protein Sequence    Length: 137 aa     Download sequence    Send to blast
MTQVSVPSNS MFDILTVRCG NCTNLLSVDM GAVTQKIPLQ GSQVHNIGSH HDHNSVDCGG  60
SSSKCNRRSP VLDSIQNDPH KTLPTPPPEK RQRVPSAYNR FIKEEIQRIK ANNPDISHRE  120
AFSTAAKNGN MLLFYM*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM6636744e-37KM663674.1 Ananas bracteatus clone 48195 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010906354.14e-52PREDICTED: protein YABBY 2-like
SwissprotQ10FZ72e-41YAB2_ORYSJ; Protein YABBY 2
TrEMBLM0TFM36e-49M0TFM3_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr7P07830_0012e-48(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP139437121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G26580.24e-41YABBY family protein